.. IntegronFinder - Detection of Integron in DNA sequences .. _tutorial: *********** Quick start *********** We assume here that the program is :ref:`installed `. You can see all available options with:: integron_finder -h For impatient ============= Go to the directory containing your input file(s), or specify the path to that file and call:: integron_finder mysequences.fst or:: integron_finder path/to/mysequences.fst It will perform a search, and outputs the results in a directory called ``Results_Integron_Finder_mysequences``. .. _IO: Input and Outputs ================= Inputs ------ ``integron_finder`` can take as an input: - a fasta file - a multi-fasta file - many (multi-)fasta files - several replicon in gembase format Gembase format """""""""""""" Integron_Finder can use *gembase* formatted protein files instead of re-annotating genes with *Prodigal*. This feature enables the user to use *Integron_Finder* with its own annotations. The *gembase* format is the typical result of *PanACoTA's* `annotation step `_ `Integron_Finder` support gembase format v1 and v2 Gembase v1 '''''''''' It must contain, at least, a *LSTINF* and a Protein file per replicon. Folder structure must have the following architecture. .. code-block:: text gembase/ ├── Genes │   ├── ACBA.0917.00019.gen # genome in fasta format one seq/gene │   └── ESCO001.C.00001.C001.gen ├── LSTINFO │   ├── ACBA.0917.00019.lst # information in space separated values │   └── ESCO001.C.00001.C001.lst ├── Proteins │   ├── ACBA.0917.00019.prt # proteins in fasta format │   └── ESCO001.C.00001.C001.prt └── Replicons ├── ACBA.0917.00019.fna # genome in fasta format one seq/replicon └── ESCO001.C.00001.C001.fst 5 first sequences headers in gembase/Genes/ACBA.0917.00019.gen file .. code-block:: text >ACBA.0917.00019.b0001_00001 1215 tyrS | Tyrosine--tRNA ligase | 6.1.1.1 | similar to AA sequence:UniProtKB:P41256 >ACBA.0917.00019.i0001_00002 1128 anmK | Anhydro-N-acetylmuramic acid kinase | 2.7.1.170 | similar to AA sequence:UniProtKB:Q8EHB5 >ACBA.0917.00019.i0001_00003 846 ephA | Epoxide hydrolase A | 3.3.2.10 | similar to AA sequence:UniProtKB:I6YGS0 >ACBA.0917.00019.i0001_00004 336 erpA | Iron-sulfur cluster insertion protein ErpA | NA | similar to AA sequence:UniProtKB:P45344 >ACBA.0917.00019.i0001_00005 1005 NA | hypothetical protein | NA | NA ... 5 first sequences headers in gembase/Genes/ACBA.0917.00019.gen file .. code-block:: text >ACBA.0917.00019.b0001_00001 1215 tyrS | Tyrosine--tRNA ligase | 6.1.1.1 | similar to AA sequence:UniProtKB:P41256 >ACBA.0917.00019.i0001_00002 1128 anmK | Anhydro-N-acetylmuramic acid kinase | 2.7.1.170 | similar to AA sequence:UniProtKB:Q8EHB5 >ACBA.0917.00019.i0001_00003 846 ephA | Epoxide hydrolase A | 3.3.2.10 | similar to AA sequence:UniProtKB:I6YGS0 >ACBA.0917.00019.i0001_00004 336 erpA | Iron-sulfur cluster insertion protein ErpA | NA | similar to AA sequence:UniProtKB:P45344 >ACBA.0917.00019.i0001_00005 1005 NA | hypothetical protein | NA | NA ... 5 first lines in gembase/LSTINFO/ACBA.0917.00019.lst .. code-block:: text 266 1480 C CDS ACBA.0917.00019.b0001_00001 tyrS | Tyrosine--tRNA ligase | 6.1.1.1 | similar to AA sequence:UniProtKB:P41256 1560 2687 D CDS ACBA.0917.00019.i0001_00002 anmK | Anhydro-N-acetylmuramic acid kinase | 2.7.1.170 | similar to AA sequence:UniProtKB:Q8EHB5 2815 3660 D CDS ACBA.0917.00019.i0001_00003 ephA | Epoxide hydrolase A | 3.3.2.10 | similar to AA sequence:UniProtKB:I6YGS0 3716 4051 C CDS ACBA.0917.00019.i0001_00004 erpA | Iron-sulfur cluster insertion protein ErpA | NA | similar to AA sequence:UniProtKB:P45344 4176 5180 C CDS ACBA.0917.00019.i0001_00005 NA | hypothetical protein | NA | NA ... **all** sequences headers in gembase/Replicons/ACBA.0917.00019.fna .. code-block:: text >ACBA.0917.00019.0001 >ACBA.0917.00019.0002 Integron_finder will use *LSTINF* and *Proteins* folders. Hence if you want to analyze a replicon located in a *gembase*, the command line should look like integron_finder --gembase data/Replicons/ACBA.0917.00019.fna Gembase v2 '''''''''' In V2 format, there is one file per genome. If there are several chromosomes or chromosomes plus plasmids, phages, ... all the sequences are in the same file. Example of Gembase v2 architecture: .. code-block:: text Gembase_v2_extraction/ ├── Genes │   ├── VICH001.0523.00090.gen │   ├── VICH001.0523.00091.gen │   ├── ... ├── LST │   ├── VICH001.0523.00090.lst │   ├── VICH001.0523.00091.lst │   ├── ... ├── Microbial0523-genomes.info ├── Microbial0523-replicons.info ├── Proteins │   ├── VICH001.0523.00090.prt │   ├── VICH001.0523.00091.prt │   ├── ... ├── RNA │   ├── VICH001.0523.00090.rna │   ├── VICH001.0523.00091.rna │   ├── ... ├── Replicons │   ├── VICH001.0523.00090.fna │   ├── VICH001.0523.00091.fna │   ├── ... └── gff ├── VICH001.0523.00090.gff3 ├── VICH001.0523.00091.gff3 ├── ... 5 first sequences headers in gembase/Genes/VICH001.0523.00090.gen file .. code-block:: text >VICH001.0523.00090.001C_00001 C ATG TAA 1 2961008 1128 mltC FKV26_RS00005 WP_001230176.1 membrane-bound_lytic_murein_transglycosylase_MltC ATGAGAAAGTTAGTGTTATGTATCACCGCTCTATTATTGAGTGGCTGTAGTCGTGAATTTATCGAGAAAATTTACGATGTTGATTACGAGCCCACTAACCGTTTCGCCAAGAACTTAGCCGAATTACCCGGACAGTTTCAGAAAGACACCGCCGCACTGGATGCATTAATCAACAGCTTCTCCGGCAATATCGAAAAACGTTGGGGGCGCCGCGAGCTA >VICH001.0523.00090.001C_00002 C ATG TAG 913 1185 273 NA FKV26_RS00010 WP_000124739.1 oxidative_damage_protection_protein ATGGCTCGCACCGTATTTTGTACCCGATTGCAGAAAGAAGCCGATGGCTTGGATTTCCAACTCTATCCCGGAGAACTGGGCAAACGCATTTTCGACAACATCTGCAAAGAAGCTTGGGCACAATGGCAGACCAAACAGACCATGCTGATCAATGAAAAAAAACTCAACATGATGGATCCTGAGCACCGCAAATTGCTGGAGCAAGAAATGGTGAGCTTC >VICH001.0523.00090.001C_00003 C GTG TAA 1199 2260 1062 mutY FKV26_RS00015 WP_001995048.1 A/G-specific_adenine_glycosylase ... *VICH001.0523.00090* contains 2 chromosomes 001C and 002C 5 first lines of chromosome 1 and 2 in gembase/LST/VICH001.0523.00090.lst .. code-block:: text 1 2961008 C CDS VICH001.0523.00090.001C_00001 FKV26_RS00005 mltC WP_001230176.1 membrane-bound_lytic_murein_transglycosylase_MltC 4.2.2.- COORDINATES:_similar_to_AA_sequence:RefSeq:WP_001230183.1 GO:0008933_-_lytic_transglycosylase_activity_[Evidence_IEA] Derived_by_automated_computational_analysis_using_gene_prediction_method:_Protein_Homology. 913 1185 C CDS VICH001.0523.00090.001C_00002 FKV26_RS00010 NA WP_000124739.1 oxidative_damage_protection_protein NA COORDINATES:_similar_to_AA_sequence:RefSeq:WP_005482430.1 GO:0005506_-_iron_ion_binding_[Evidence_IEA] Derived_by_automated_computational_analysis_using_gene_prediction_method:_Protein_Homology. 1199 2260 C CDS VICH001.0523.00090.001C_00003 FKV26_RS00015 mutY WP_001995048.1 A/G-specific_adenine_glycosylase 3.2.2.31 COORDINATES:_similar_to_AA_sequence:RefSeq:WP_014505785.1 GO:0019104_-_DNA_N-glycosylase_activity_[Evidence_IEA] Derived_by_automated_computational_analysis_using_gene_prediction_method:_Protein_Homology. 2500 3219 D CDS VICH001.0523.00090.001C_00004 FKV26_RS00020 trmB WP_000005581.1 tRNA_(guanosine(46)-N7)-methyltransferase_TrmB 2.1.1.33 COORDINATES:_similar_to_AA_sequence:RefSeq:WP_001898008.1 GO:0008176_-_tRNA_(guanine-N7-)-methyltransferase_activity_[Evidence_IEA] Derived_by_automated_computational_analysis_using_gene_prediction_method:_Protein_Homology. 3330 4250 D CDS VICH001.0523.00090.001C_00005 FKV26_RS00025 glsB WP_000805054.1 glutaminase_B 3.5.1.2 COORDINATES:_similar_to_AA_sequence:RefSeq:WP_002046360.1 GO:0004359_-_glutaminase_activity_[Evidence_IEA] Derived_by_automated_computational_analysis_using_gene_prediction_method:_Protein_Homology. ... 15 1373 D CDS VICH001.0523.00090.002C_02705 FKV26_RS13475 glpT WP_000462380.1 glycerol-3-phosphate_transporter NA COORDINATES:_similar_to_AA_sequence:RefSeq:WP_019829515.1 GO:0015169_-_glycerol-3-phosphate_transmembrane_transporter_activity_[Evidence_IEA] Derived_by_automated_computational_analysis_using_gene_prediction_method:_Protein_Homology. 1527 2594 D CDS VICH001.0523.00090.002C_02706 FKV26_RS13480 glpQ WP_000917229.1 glycerophosphodiester_phosphodiesterase 3.1.4.46 COORDINATES:_similar_to_AA_sequence:RefSeq:WP_005524061.1 GO:0008081_-_phosphoric_diester_hydrolase_activity_[Evidence_IEA] Derived_by_automated_computational_analysis_using_gene_prediction_method:_Protein_Homology. 2647 3327 C CDS VICH001.0523.00090.002C_02707 FKV26_RS13485 NA WP_001177500.1 Crp/Fnr_family_transcriptional_regulator NA COORDINATES:_similar_to_AA_sequence:RefSeq:WP_001887744.1 NA Derived_by_automated_computational_analysis_using_gene_prediction_method:_Protein_Homology. 3467 4198 C CDS VICH001.0523.00090.002C_02708 FKV26_RS13490 NA WP_000027384.1 nucleoside_phosphorylase NA COORDINATES:_similar_to_AA_sequence:RefSeq:WP_001897923.1 NA Derived_by_automated_computational_analysis_using_gene_prediction_method:_Protein_Homology. 4195 4920 C CDS VICH001.0523.00090.002C_02709 FKV26_RS13495 pnuC WP_001995272.1 nicotinamide_riboside_transporter_PnuC NA COORDINATES:_similar_to_AA_sequence:RefSeq:WP_001933049.1 GO:0015663_-_nicotinamide_mononucleotide_transmembrane_transporter_activity_[Evidence_IEA] Derived_by_automated_computational_analysis_using_gene_prediction_method:_Protein_Homology. 5 sequences of chromosome 1 and 2 in gembase/Proteins/VICH001.0523.00090.prt .. code-block:: text >VICH001.0523.00090.001C_00001 C ATG TAA 1 2961008 375 mltC FKV26_RS00005 WP_001230176.1 membrane-bound_lytic_murein_transglycosylase_MltC MRKLVLCITALLLSGCSREFIEKIYDVDYEPTNRFAKNLAELPGQFQKDTAALDALINSFSGNIEKRWGRRELKIAGKNNYVKYIDNYLSRSEVNFTEGRIIVETVSPIDPKAHLRNAIITTLLTPDDPAHVDLFSSKDIELKGQPFLYQQVLDQDGQPIQWSWRANRYADY >VICH001.0523.00090.001C_00002 C ATG TAG 913 1185 90 NA FKV26_RS00010 WP_000124739.1 oxidative_damage_protection_protein MARTVFCTRLQKEADGLDFQLYPGELGKRIFDNICKEAWAQWQTKQTMLINEKKLNMMDPEHRKLLEQEMVSFLFEGKEVHIEGYTPPAK ... >VICH001.0523.00090.002C_02705 D ATG TAA 15 1373 452 glpT FKV26_RS13475 WP_000462380.1 glycerol-3-phosphate_transporter MFELFKPTAHTQRLPSDKVDSVYSRLRWQLFIGIFVGYAGYYLVRKNFSLAMPYLIEQGFSRGDLGVALGAVSIAYGLSKFLMGNVSDRSNPRYFLSAGLLLSALVMFCFGFMPWATGSITAMFILLFLNGWFQGMGWPACGRTMVHWWSRKER >VICH001.0523.00090.002C_02706 D ATG TAA 1527 2594 355 glpQ FKV26_RS13480 WP_000917229.1 glycerophosphodiester_phosphodiesterase MLKPFSLSLLALACSTSLFSSIVSAEPIVIAHRGASGYLPEHTLEAKTLAYAMKPDYIEQDVVMTKDDQLVVLHDHYLDRVTDVAERFPNRARADGRYYAIDFTLAEIKTLRVTEGFNIDDQGKKVAGFPDRFPIWKGDFTVPTLAEEIELIQGLNKTLG **all** sequences headers in gembase/Replicons/VICH001.0523.00090.fna .. code-block:: text >VICH001.0523.00090.001C 2023-05-16 2961008 bp Vibrio cholerae O1 strain AAS91 chromosome 1, complete sequence >VICH001.0523.00090.002C 2023-05-16 1124701 bp Vibrio cholerae O1 strain AAS91 chromosome 2, complete sequence Integron_finder will use *LST* (or *LSTINF(O)* for Gembase v1) and *Proteins* folders. Hence if you want to analyze a replicon located in a *gembase*, the command line should look like .. code-block:: shell integron_finder --gembase data/My_base/Replicons/ACBA.0917.00019.fna .. note:: If the replicon you want to analyze is not in the gembase directory, but you still want to take advantage of the *gembase* annotation, then you have to specify the *--gembase-path* option to indicate where to find it. A typical command line could be: :: integron_finder --gembase --gembase-path data/gembase/ My_replicons/ACBA.0917.00019.fna .. note:: The gembase format implies different default topology (`Topology`_) Custom protein file ------------------- Integron_Finder allow the user to provide it's own protein file with it's own annotations instead of using *prodigal* (default). In this case you have to specified the protein file to use with the option *--prot-file* and the path to the parser to extract information from this file *--annot-parser*. A typical command line could be: integron_finder --prot-file --annot-parser The annotation parser must be a python file (with the *.py* extension') with one function called *description_parser* This function must take **one** argument which is the header of a fasta sequence header (without the first character >) and must return a **tuple with 4 elements**: * sequence id: the id of the sequence (string) * start: the beginning position of the protein on the genome (positive int) * stop: the end position of the protein on the genome (positive int) * strand: the strand 1 if the protein os coded on the direct strand or -1 on the reverse Below a description_parser to parse annotation in prodigal format: .. literalinclude:: ../_static/prodigal_annot_parser.py :language: python Outputs ------- By default, ``integron_finder`` will output 3 files under ``Results_Integron_Finder_mysequences``: - ``mysequences.integrons`` : A file with all integrons and their elements detected in all sequences in the input file. - ``mysequences.summary`` : A summary file with the number and type of integrons per sequence. - ``integron_finder.out`` : A copy standard output. The stdout can be silenced with the argument ``--mute`` The amount of log in the standard output can be controlled with ``--verbose`` for more or ``--quiet`` for less, and both are cumulative arguments, eg. ``-vv`` or ``-qq``. Other files can be created on demand: - ``--gbk``: Creates a Genbank files with all the annotations found (present in the ``.integrons`` file) - ``--pdf``: Creates a simple pdf graphic with complete integrons - ``--split-results``: Creates a ``.integrons`` a ``.summary`` file per replicon if the input is a multifasta file. - ``--keep-tmp``: Keep temporary files. See :ref:`Keep intermediate files ` for more. For everyone ============ .. note:: The different options will be shown separately, but they can be used altogether unless otherwise stated. .. _local_max: Thorough local detection ------------------------ This option allows a much more sensitive search of *attC* sites. It will be slower if integrons are found, but will be as fast if nothing is detected. .. code-block:: bash integron_finder mysequences.fst --local-max .. _calin_threshold: CALIN detection --------------- By default CALIN are reported if they are composed of at least 2 *attC* sites, in order to avoid false positives. This value was chosen as CALIN with 2 attC sites were unlikely to be false positive. The probability of a false CALIN with at least 2 attC sites within 4kb was estimated between 4.10^-6 and 7.10^-9. However, one can modify this value with the option `--calin-threshold` and use a lower or higher value depending on the risk one is willing to take:: integron_finder mysequences.fst --calin-threshold 1 .. note:: If ``--local-max`` is called, it will run around CALINs with single attC sites, even if ``--calin-threshold`` is 2. The filtering step is done after the search with local max in that case. .. _func_annot: Functional annotation --------------------- This option allows to annotate cassettes given HMM profiles. As AMRFinderPlus database is distributed, to annotate antibiotic resistance genes, just use:: integron_finder mysequences.fst --func-annot IntegronFinder will look in the directory ``Integron_Finder-x.x/data/Functional_annotation`` and use all ``.hmm`` files available to annotate. By default, there is only ``NCBIfam-AMRFinder.hmm``, but one can add any other HMM file here. Alternatively, if one wants to use a database which is present elsewhere on the user's computer without copying it into that directory, one can specify the following option :: integron_finder mysequences.fst --path_func_annot bank_hmm where ``bank_hmm`` is a file containing one absolute path to a hmm file per line, and you can comment out a line :: ~/Downloads/Integron_Finder-x.x/data/Functional_annotation/NCBIfam-AMRFinder.hmm ~/Documents/Data/Pfam-A.hmm # ~/Documents/Data/Pfam-B.hmm Here, annotation will be made using Pfam-A et NCBIfam-AMRFinder, but not Pfam-B. If a protein is hit by 2 different profiles, the one with the best e-value will be kept. Search for promoter and *attI* sites ------------------------------------ By default ``integron_finder`` look for *attC* sites and site-specific integron integrase,, If you want to search for known promoters (integrase, Pc-int1 and Pc-int3) and AttI sites in integrons elements you need to add the ``--promoter-attI`` option on the command line. .. _tempfile: Keep intermediate results ------------------------- Integrons finder needs some intermediate results to run completely. It includes notably the protein file in fasta (mysequences.prt), but also the outputs from hmmer and infernal. A folder containing these outputs is generated for each replicon and have name ``tmp_`` This directory is removed at the end. You can keep this directory to analyse further each ``integron_finder`` steps with the option ``--keep-tmp``. Using this argument allows you to rerun ``integron_finder`` on the same sequences without redetecting proteins and attC sites. It is useful if one wants to change clustering parameters, evalues of attC sites, or size of them. Note that it won't search for new attC sites so it is better to start with relaxed parameters and then rerun ``integron_finder`` with more strict parameters. See the section :ref:`for integron diggers ` for more informations For each tmp file, there are: - ``.fst``: a single fasta file with the replicon_name - ``.prt``: a multifasta file with the sequences of the detected proteins. - ``_intI_table.res``: hmm result for the intI hmm profile in tabular format - ``_intI.res``: hmm result for the intI hmm profile - ``_phage_int_table.res``: hmm result for the tyrosine recombinase hmm profile in tabular format - ``_phage_int.res``: hmm result for the tyrosine recombinase hmm profile in tabular format - ``_attc_table.res``: cmsearch result for the attC sites covariance model in tabular format - ``_attc.res``: significant (according to ``evalue-attc``) attC sites aligned in stockholm format - ``integron_max.pickle``: pickle file so ``integron_finder`` reuse this instead of re-running the local_max part Topology -------- For regular sequence file format """"""""""""""""""""""""""""""""" By default, IntegronFinder assumes that * your replicon is considered as **circular** if there is **only one replicon** in the input file. * your replicons are considered as **linear** if there are **several replicons** in the input file. For sequence in GemBase format """""""""""""""""""""""""""""" By default, IntegronFinder assumes that * Your replicon is considered as **circular** if it's a **Complete** Relicon and it's a **Chromosome** or **Plasmid**. Even there are several replicons in the same file. * If your replicons are a **Phage**, **Other** or a **Draft**. They will be considered by default as **linear**. Whatever The sequence format """""""""""""""""""""""""""" However, you can change this default behavior and specify the default topology with options ``--circ`` or ``--lin`` on the command line:: integron_finder --lin mylinearsequence.fst integron_finder --circ mycircularsequence.fst If you have multiple replicon in the input file with different topologies you can specify a topology for each replicon by providing a topology file. The syntax for the topology file is simple: * one topology by line * one line start by the seqid followed by 'circ' or 'lin' for circular or linear topologies. example:: seq_id_1 circ seq_id_2 lin You can also mix the options ``--circ`` or ``--lin`` with option ``--topology-file``:: integron_finder --circ --topology-file path/to/topofile mysequencess.fst In the example above the default topology is set to *circular*. The replicons specified in topofile supersede the default topology. .. warning:: However, if the replicon is smaller than ``4 x dt`` (where ``dt`` is the distance threshold, so 4kb by default), the replicon is considered linear to avoid clustering problem. The topology used to searching integron is report in the *\*.integrons file* For big data people =================== .. _parallel: Parallelization --------------- The time limiting part are HMMER (search integrase) and INFERNAL (search *attC* sites). So if you have to analyze one or few replicons the user can set the number of CPU used by HMMER and INFERNAL:: integron_finder mysequences.fst --cpu 4 Default is 1. .. warning:: Increasing too much (usually above 4) the number of CPUs used may lower the performance of the software. Please refer to the documentation of HMMER and INFERNAL for more details. If you want to deal with a fasta file with a lot of replicons (from 10 to more than thousand) we provide a workflow to parallelize the execution of the data. This mean that we cut the data input into chunks (by default of one replicon) then execute IntegronFinder in parallel on each replicon (the number of parallel tasks can be limited) then aggregate the results in one global summary. The workflow use the `nextflow `_ framework and can be run on a single machine or a cluster. First, you have to install `nextflow `_ first, and :ref:`integron_finder `. Then we provide 2 files (you need to download them from the IntegronFinder github repo.) - `parallel_integron_finder.nf` which is the workflow itself in nextflow syntax - `nextflow.config` which is a configuration file to execute the workflow. The workflow file should not be modified. Whereas the profile must be adapted to the local architecture. The file `nextflow.config` provide for profiles: - a standard profile for local use - a cluster profile - a standard profile using apptainer container - a cluster profile using apptainer container so now install nextflow. If you have capsule error like :: CAPSULE EXCEPTION: Error resolving dependencies. while processing attribute Allow-Snapshots: false (for stack trace, run with -Dcapsule.log=verbose) Unable to initialize nextflow environment install nextflow (>=0.29.0) as follow (change the nextflow version with the last release) :: wget -O nextflow http://www.nextflow.io/releases/v0.30.2/nextflow-0.30.2-all chmod 777 nextflow for more details see: https://github.com/nextflow-io/nextflow/issues/770#issuecomment-400384617 How to get parallel_integron_finder """""""""""""""""""""""""""""""""""" The release contains the workflow `parallel_integron_finder.nf` and the `nextflow.config` at the top level of the archive But If you use pip to install Integron_Finder you have not easily access to them. But they can be downloaded or executed directly by using nextflow. to download it :: nextflow pull gem-pasteur/Integron_Finder to get the latest version or use *-r* option to specify a version :: nextflow pull -r release_2.0 gem-pasteur/Integron_Finder to see what you download :: nextflow see Integron_Finder to execute it directly :: nextflow run gem-pasteur/Integron_Finder -profile standard --replicons all_coli.fst --circ or:: nextflow run -r release_2.0 gem-pasteur/Integron_Finder -profile standard --replicons all_coli.fst --circ standard profile """""""""""""""" This profile is used if you want to parallelize IntegronFinder on your machine. You can specify the number of tasks in parallel by setting the queueSize value :: standard { executor { name = 'local' queueSize = 7 } process{ executor = 'local' $integron_finder{ errorStrategy = 'ignore' cpu=params.cpu } } } If you installed IntegronFinder with apptainer, just uncomment the container line in the script, and set the proper path to the container. All options available in non parallel version are also available for the parallel one. except the ``--outdir`` which is not available and ``--replicons`` option which is specific to the parallelized version. ``--replicons`` allows to specify the path of a file containing the replicons. A typical command line will be:: ./parallel_integron_finder.nf -profile standard --replicons all_coli.fst --circ .. note:: Joker as ``*`` or ``?`` can be used in path to specify several files as input. But **do not forget** to protect the wild card from the shell for instance by enclosing your glob pattern with simple quote. :: nextflow run -profile standard parallel_integron_finder.nf --replicons 'replicons_dir/*.fst' Two asterisks, i.e. ``**``, works like ``*`` but crosses directory boundaries. Curly brackets specify a collection of sub-patterns. :: nextflow run -profile standard parallel_integron_finder.nf --replicons 'data/**.fa' nextflow run -profile standard parallel_integron_finder.nf --replicons 'data/**/*.fa' nextflow run -profile standard parallel_integron_finder.nf --replicons 'data/file_{1,2}.fa' The first line will match files ending with the suffix `.fa` in the `data` folder and recursively in all its sub-folders. While the second one only match the files which have the same suffix in any sub-folder in the data path. Finally the last example capture two files: `data/file_1.fa`, `data/file_2.fa` More than one path or glob pattern can be specified in one time using comma. **Do not** insert spaces surrounding the comma :: nextflow run -profile standard parallel_integron_finder --replicons 'some/path/*.fa,other/path/*.fst' The command above will analyze all files ending by `.fa` in `/some/path` with `.fst` extension in `other/path` For further details see: https://www.nextflow.io/docs/latest/channel.html#frompath .. note:: The option `--outdir` is not allowed. Because you can specify several replicon files as input, So in this circumstances specify only one name for the output is a none sense. .. note:: The options starting with one dash are for nextflow workflow engine, whereas the options starting by two dashes are for integron_finder workflow. .. note:: Replicons will be considered linear by default (see above), here we use `--circ` to consider replicons circular. .. note:: If you specify several input files, the split and merge steps will be parallelized. If you execute this line, 2 kinds of directories will be created. * One named `work` containing lot of subdirectories this for all jobs launch by nextflow. * Directories named `Results_Integron_Finder_XXX` where XXX is the name of the replicon file. So, one directory per replicon file will be created. These directories contain the final results as in non parallel version. cluster profile """"""""""""""" The cluster profile is intended to work on a cluster managed by SLURM. If your cluster is managed by an other drm replace executor name by the right value (see `nextflow supported cluster `_ ) You can also manage - The number of tasks in parallel with the `executor.queueSize` parameter (here 500). If you remove this line, the system will send in parallel as many jobs as there are replicons in your data set. - The queue (or partition in SLURM terminology) with `process.queue` parameter (here common,dedicated) - and some options specific to your cluster management systems with `process.clusterOptions` parameter :: cluster { executor { name = 'slurm' queueSize = 500 } process{ executor = 'slurm' queue= 'common,dedicated' clusterOptions = '--qos=fast' $integron_finder{ cpu=params.cpu } } } To run the parallel version on a cluster, for instance on a cluster managed by slurm, I can launch the main nextflow process in one slot. The parallelization and the submission on the other slots is made by nextflow itself. Below a command line to run parallel_integron_finder and use 2 cpus per integron_finder task, each integron_finder task can be executed on a different machine, each integron_finder task claim 2 cores (cpus in nextflow terminology) to speed up the attC sites or integrase search:: sbatch --qos fast -p common nextflow run parallel_integron_finder.nf -profile cluster --replicons all_coli.fst --cpu 2 --local-max --gbk --circ The results will be the same as described in local execution. apptainer (formely singularity) profiles """""""""""""""""""""""""""""""""""""""" If you use the integron_finder image with the `apptainer `_ container executor, use the profile *standard_apptainer*. With the command line below nextflow will download parallel_integron_finder from github and download the integron_finder image from the docker hub and convert it to apptainer on the fly so you haven't to install anything except nextflow and apptainer. :: nextflow run gem-pasteur/Integron_Finder -profile standard_apptainer --replicons all_coli.fst --circ You can also use the integron_finder apptainer image on a cluster, for this use the profile *cluster_apptainer*. :: sbatch --qos fast -p common nextflow run gem-pasteur/Integron_Finder:2.0 -profile cluster_apptainer --replicons all_coli.fst --cpu 2 --local-max --gbk --circ In the case of your cluster cannot reach the world wide web. you have to download the apptainer image :: apptainer pull --name Integron_Finder docker pull gempasteur/integron_finder: the move the image on your cluster modify the nextflow.config to point on the location of the image, and adapt the cluster options (executor, queue, ...) to your architecture .. code-block:: text cluster_apptainer { executor { name = 'slurm' queueSize = 500 } process { container = /path/to/integron_finder/image queue = 'common,dedicated' clusterOptions = '--qos=fast' withName: integron_finder { cpus = params.cpu } } singularity { enabled = true runOptions = '-B /pasteur' autoMounts = false } } } then run it :: sbatch --qos fast -p common nextflow run ./parallel_integron_finder.nf -profile cluster_singualrity --replicons all_coli.fst --cpu 2 --local-max --gbk --circ If you want to have more details about the jobs execution you can add some options to generate report: Execution report """""""""""""""" To enable the creation of this report add the ``-with-report`` command line option when launching the pipeline execution. For example: :: nextflow run ./parallel_integron_finder.nf -profile standard -with-report [file name] --replicons It creates an HTML execution report: a single document which includes many useful metrics about a workflow execution. For further details see https://www.nextflow.io/docs/latest/tracing.html#execution-report Trace report """""""""""" In order to create the execution trace file add the ``-with-trace`` command line option when launching the pipeline execution. For example: :: nextflow run ./parallel_integron_finder.nf -profile standard -with-trace --replicons It creates an HTML timeline for all processes executed in your pipeline. For further details see https://www.nextflow.io/docs/latest/tracing.html#timeline-report Timeline report """"""""""""""" To enable the creation of the timeline report add the ``-with-timeline`` command line option when launching the pipeline execution. For example: :: nextflow run ./parallel_integron_finder.nf -profile standard -with-timeline [file name] --replicons ... It creates an execution tracing file that contains some useful information about each process executed in your pipeline script, including: submission time, start time, completion time, cpu and memory used. For further details see https://www.nextflow.io/docs/latest/tracing.html#trace-report .. _advance: For integron diggers ==================== Many options are set to prevent false positives. However, one may want higher sensitivity at the expense of having potentially false positives. Ultimately, only experimental experiments will tell whether a given *attC* sites or integrase is functional. Also, note that because of how local_max works (ie. around already detected elements), true *attC* sites may be found thanks to false *attC* sites, because false *attC* sites may trigger local_max around them. Hence, one may want to use very relaxed parameters first with the ``--keep-tmp`` flag to rerun the analysis on the same data while restrincting the parameters. .. _distance_threshold: Clustering of elements ---------------------- *attC* sites are clustered together if they are on the same strand and if they are less than 4 kb apart (``-dt 4000`` by default). To cluster an array of *attC* sites and an integron integrase, they also must be less than 4 kb apart. This value has been empirically estimated and is consistent with previous observations showing that biggest gene cassettes are about 2 kb long. This value of 4 kb can be modified though:: integron_finder mysequences.fst --distance-thresh 10000 or, equivalently:: integron_finder mysequences.fst -dt 10000 This sets the threshold for clustering to 10 kb. .. note:: The option ``--outdir`` allows you to chose the location of the Results folder (``Results_Integron_Finder_mysequences``). If this folder already exists, IntegronFinder will not re-run analyses already done, except functional annotation. It allows you to re-run rapidly IntegronFinder with a different ``--distance-thresh`` value. Functional annotation needs to re-run each time because depending on the aggregation parameters, the proteins associated with an integron might change. Integrase --------- We use two HMM profiles for the detection of the integron integrase. One for tyrosine recombinase and one for a specific part of the integron integrase. To be specific we use the intersection of both hits, but one might want to use the union of both hits (and sees whether it exists cluster of attC sites nearby non integron-integrase...). To do so, use:: integron_finder mysequences.fst --union-integrases *attC* evalue ------------- The default evalue is 1. Sometimes, degenerated *attC* sites can have a evalue above 1 and one may want to increase this value to have a better sensitivity. :: integron_finder mysequences.fst --evalue-attc 5 Here is a plot of how the sensitivity and false positive rate evolve as a function of the evalue: |attC_evalue| .. |attC_evalue| image:: /_static/evalue_attC.* :align: middle :width: 400px :alt: attC evalue .. note:: If one wants to have maximum sensitivity, use a high evalue (max is 10), and then integron_finder can be run again on the same data with a lower evalue. It won't work the other way around (starting with low evalue), as attC sites are not searched again. *attC* size ----------- By default, *attC* sites' size ranges from 40 to 200bp. This can be changed with the ``--min-attc-size`` or ``--max-attc-size`` parameters:: integron_finder mysequences.fst --min-attc-size 50 --max-attc-size 100 Palindromes ----------- *attC* sites are more or less palindromic sequences, and sometimes, a single *attC* site can be detected on the 2 strands. By default, the one with the highest evalue is discarded, but you can choose to keep them with the following option:: integron_finder mysequences.fst --keep-palindromes *attC* alignements ------------------ One can get the alignements of *attC* sites in the temporary files (use ``--keep-tmp``) to have them. Under ``Results_Integron_Finder_mysequences/tmp_repliconA/repliconA_attc.res`` one can find alignements of *attC* sites from repliconA, in Stokholm format, where R and L core regions are aligned with each others:: # STOCKHOLM 1.0 #=GF AU Infernal 1.1.2 ACBA.0917.00019.0001/315102-315161 GUCUAACAAUUC---GUUCAAGCcgacgccgcu.................................................ucgcggcgcgGCUUAACUCAAGC----GUUAGAU #=GR ACBA.0917.00019.0001/315102-315161 PP ************...******************.................................................***********************....******* ACBA.0917.00019.0001/313260-313368 ACCUAACAAUUC---GUUCAAGCcgagaucgcuucgcggccgcggaguuguucggaaaaauugucacaacgccgcggccgcaaagcgcuccgGCUUAACUCAGGC----GUUGGGC #=GR ACBA.0917.00019.0001/313260-313368 PP ************...******************************************************************************************....******* ACBA.0917.00019.0001/313837-313906 GCCCAACAUGGC---GCUCAAGCcgaccggccagcccu.......................................gcgggcuguccgucgGCUUAGCUAGGGC----GUUAGAG #=GR ACBA.0917.00019.0001/313837-313906 PP ************...***********************.......................................****************************....******* #=GC SS_cons <<<<<<<--------<<<-<<<<.....................................................................>>>>>>>---------->>>>>>> #=GC RF [Rsec=]========[=Lsec=].....................................................................[Lprim]==========[Rprim] // Which you can manipulate easily with ``esl-alimanip`` tools provided by infernal (the following examples should work if your ``cmsearch`` is in your ``PATH``). You can convert the same alignement in dna alphabet (cmsearch use RNA alphabet):: $ esl-alimanip --dna Results_Integron_Finder_mysequences/tmp_ACBA.0917.00019.0001/ACBA.0917.00019.0001_attc.res # STOCKHOLM 1.0 #=GF AU Infernal 1.1.2 ACBA.0917.00019.0001/315102-315161 GTCTAACAATTC---GTTCAAGCCGACGCCGCT-------------------------------------------------TCGCGGCGCGGCTTAACTCAAGC----GTTAGAT #=GR ACBA.0917.00019.0001/315102-315161 PP ************...******************.................................................***********************....******* ACBA.0917.00019.0001/313260-313368 ACCTAACAATTC---GTTCAAGCCGAGATCGCTTCGCGGCCGCGGAGTTGTTCGGAAAAATTGTCACAACGCCGCGGCCGCAAAGCGCTCCGGCTTAACTCAGGC----GTTGGGC #=GR ACBA.0917.00019.0001/313260-313368 PP ************...******************************************************************************************....******* ACBA.0917.00019.0001/313837-313906 GCCCAACATGGC---GCTCAAGCCGACCGGCCAGCCCT---------------------------------------GCGGGCTGTCCGTCGGCTTAGCTAGGGC----GTTAGAG #=GR ACBA.0917.00019.0001/313837-313906 PP ************...***********************.......................................****************************....******* #=GC SS_cons <<<<<<<--------<<<-<<<<.....................................................................>>>>>>>---------->>>>>>> #=GC RF [Rsec=]========[=Lsec=].....................................................................[Lprim]==========[Rprim] // You can also convert it to fasta format:: $ esl-alimanip --dna --outformat afa Results_Integron_Finder_mysequences/tmp_ACBA.0917.00019.0001/ACBA.0917.00019.0001_attc.res >ACBA.0917.00019.0001/315102-315161 GTCTAACAATTC---GTTCAAGCCGACGCCGCT--------------------------- ----------------------TCGCGGCGCGGCTTAACTCAAGC----GTTAGAT >ACBA.0917.00019.0001/313260-313368 ACCTAACAATTC---GTTCAAGCCGAGATCGCTTCGCGGCCGCGGAGTTGTTCGGAAAAA TTGTCACAACGCCGCGGCCGCAAAGCGCTCCGGCTTAACTCAGGC----GTTGGGC >ACBA.0917.00019.0001/313837-313906 GCCCAACATGGC---GCTCAAGCCGACCGGCCAGCCCT---------------------- -----------------GCGGGCTGTCCGTCGGCTTAGCTAGGGC----GTTAGAG The possible outformat are: - stockholm - pfam - a2m - psiblast - afa